PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G02550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 1477aa    MW: 160727 Da    PI: 7.7491
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G02550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS237.84.6e-73343319374
             GRAS  19 laqalLarlsel..aspdg.dpmqRlaayfteALaarlarsvselykal.ppsetsekn..sseelaalkl.fsevsPilkfshltaNqaIlea 105
                      +a+++Lar   l  a+ +g  p +Rla  ++  La+rl+r v+ + +al  ps   +++   + +  + k+  s + P+l+       + + ++
  ORUFI11G02550.1   3 KATRCLARATGLaaAAAAGdGPRKRLAVAMVDCLARRLLRPVQAITDALiDPSVYLDRRsvRAARRGVGKMvTSPLAPCLTCIKNSNGEGVRQS 96 
                      6788888888775444555479************************9996444333222122222233333589999******99999999999 PP

             GRAS 106 vegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL.... 194
                        ++ +     f+i+ + QW+ Ll++L  Rpegpp  +R+T+v++    + e l +++e  ++ Aeelg++f+f+  v+ +ledl++++L    
  ORUFI11G02550.1  97 HTENPAF----FSIKLPCQWIQLLHELRRRPEGPPrVVRLTVVHD----DGELLAKMEELVSDEAEELGMEFQFHG-VVGQLEDLDFSNLrnvl 181
                      9999887....********************9988789*******....***************************.7999****999986666 PP

             GRAS 195 rvkpgEalaVnlvlqlhrll....................................................................desvsl 220
                      ++k+gEal+V++ lqlhrll                                                                    + +++l
  ORUFI11G02550.1 182 EIKSGEALVVSCTLQLHRLLaadddamyssrsahlnqmasiaqlqhmavnscpsssgggsvqykdddpyrspatpltfvsppvstphfQTPAAL 275
                      7889*****************************************************************************9986555555555 PP

             GRAS 221 eserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres........eerikvErellgreivnvvacegaerr 306
                           ++L++v+ lsPk++vv+eq+adhn+ sF +rf+eal++y+a+fdsl+a ++++s        +er+ vEr+++g+ei+ v+   ga+rr
  ORUFI11G02550.1 276 ----ASFLSAVRALSPKILVVAEQDADHNGVSFRKRFCEALHHYAAVFDSLDAAAATTSaasrlwspDERAQVERVVVGEEIKGVLLRDGAHRR 365
                      ....55*********************************************99988888888999999************************** PP

             GRAS 307 erhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      e h +l++W +r+e+aGF+ vpls+ a k+ + ++r+++ +  + +e  g+l+l+W++rpL+s+SaWr
  ORUFI11G02550.1 366 EWHDRLRQWAARMEMAGFTGVPLSYAAIKKGNDMVRRCGLRRCENKECGGCLLLCWSSRPLYSISAWR 433
                      ***************************************887999999*******************8 PP

2GRAS233.11.2e-715469352344
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkfs 94 
                      v lL ecA +v++g++e+a+   ++++ l   ++ p+qRl + ++  La+rl++s ++l  al  ps+    + s+  aa++ f+++ P+l  +
  ORUFI11G02550.1 546 VPLLHECASHVTEGSFEKADFSFKKIRMLT-IADGPLQRLSTIIVDSLAHRLLSSIQGLPGALiDPSDYF--EKSTLRAARHNFFKLNPYLSTG 636
                      6789**********************9876.5667*******************9999998874444443..35555567778*********** PP

             GRAS  95 hltaNqaIleavege....ervHiiDfdis..qGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                      ++t N aI+ea+e e    + vHi+D++ s  ++ QW+ Ll+ +  Rp+g+p+l +T++++    +++ l  +++ L+k Ae+lgv+f+f   v
  ORUFI11G02550.1 637 FVTINWAIMEAMEDEkvdlQVVHIVDLSCSaaHPWQWLKLLDDFHGRPGGAPELYLTVLHD----DNDFLADMQSLLSKKAESLGVSFHFIS-V 725
                      ***************999999******8653389***************************....9**************************.7 PP

             GRAS 183 akrledleleeLrvkp....gEalaVnlvlqlhrll.........................................desvsleserdevLklv 231
                        rle+l++++Lr       g a+a++++lq+hrll                                           s  +++   ++L+++
  ORUFI11G02550.1 726 IGRLETLDFSNLRSTFqikfGVAVAISCALQMHRLLlvddnlsstsiaqlqkmanftqpkqmassvcspastlnylqTPSPRTPKLLARLLSAI 819
                      99**********54444555*******************************************************98666777778899***** PP

             GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                      + l+P+++ ++eq+adhn+  F +rf e l+yy+alfd+++a ++++    +er  v+r++l++ei+n++ ceg +r erhe+l +W + +ee+
  ORUFI11G02550.1 820 RALKPNIMLIMEQDADHNTLLFRDRFNEVLNYYAALFDCFHAVAAANPgrtDERLRVDRMILREEIKNILVCEGVHRHERHERLDQWAMHMEES 913
                      ****************************************77654444456******************************************* PP

             GRAS 323 GFkpvplsekaakqaklllrkv 344
                      GF++v+ls +a  +a     kv
  ORUFI11G02550.1 914 GFHNVQLSFSAIREAYVWQLKV 935
                      *********9999887655555 PP

3GRAS2477.7e-7699213392287
             GRAS    2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92  
                       + lL++cA  vs+g++ +a+ +L+++ +las d+  ++qRlaa+f+ ALa++l++   +l++al +s++s +    +  a++  ++v P+lk
  ORUFI11G02550.1  992 IGLLYQCAAEVSAGSFDRANLCLEHITQLASLDApHALQRLAAVFADALARKLLNLILGLSRALLSSANSADA-HLVPVARRHMFDVLPFLK 1082
                       679*******************************9*****************************888887544.44446778899******* PP

             GRAS   93 fshltaNqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182 
                       +++lt+N+aIlea+ege+ vH++Df+  + +++QW+aL++a+  R+egpp+lRiT+v++    ske l +++  L+k Ae++++ f+fn+ v
  ORUFI11G02550.1 1083 LAYLTTNHAILEAMEGERFVHVVDFSgpAANPVQWIALFHAFRGRREGPPHLRITAVHD----SKEFLANMAAVLSKEAEAFDIAFQFNA-V 1169
                       *************************966899****************************....9**************************.7 PP

             GRAS  183 akrledleleeL....rvkpgEalaVnlvlqlhrll........................................................ 214 
                       + +l+++++++L     v++gEalaV++vlqlhrll                                                        
  ORUFI11G02550.1 1170 EAKLDEMDFDALrhdlGVRSGEALAVSVVLQLHRLLavddgrrhaaagcltpvqiiarssprsfgellerelntrlqlspdasvvsslsphs 1261
                       999**999998843335667************************************************************************ PP

             GRAS  215 ......desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287 
                             +++++++ +  ++L++v+slsPk++v++eqea+hn++ F erf eal+yy++lfd+l+ + ++++ er+ vEr
  ORUFI11G02550.1 1262 paaataAHPTTSTPKLGSFLSAVRSLSPKIMVMTEQEANHNGGAFQERFDEALNYYASLFDCLQRS-AAAAAERARVER 1339
                       ****98555555556999*********************************************999.567788888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.3121413IPR005202Transcription factor GRAS
PfamPF035141.6E-703433IPR005202Transcription factor GRAS
PROSITE profilePS5098536.873519945IPR005202Transcription factor GRAS
PfamPF035144.2E-69546935IPR005202Transcription factor GRAS
PROSITE profilePS5098536.8179651414IPR005202Transcription factor GRAS
PfamPF035142.7E-739921339IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 1477 aa     Download sequence    Send to blast
MEKATRCLAR ATGLAAAAAA GDGPRKRLAV AMVDCLARRL LRPVQAITDA LIDPSVYLDR  60
RSVRAARRGV GKMVTSPLAP CLTCIKNSNG EGVRQSHTEN PAFFSIKLPC QWIQLLHELR  120
RRPEGPPRVV RLTVVHDDGE LLAKMEELVS DEAEELGMEF QFHGVVGQLE DLDFSNLRNV  180
LEIKSGEALV VSCTLQLHRL LAADDDAMYS SRSAHLNQMA SIAQLQHMAV NSCPSSSGGG  240
SVQYKDDDPY RSPATPLTFV SPPVSTPHFQ TPAALASFLS AVRALSPKIL VVAEQDADHN  300
GVSFRKRFCE ALHHYAAVFD SLDAAAATTS AASRLWSPDE RAQVERVVVG EEIKGVLLRD  360
GAHRREWHDR LRQWAARMEM AGFTGVPLSY AAIKKGNDMV RRCGLRRCEN KECGGCLLLC  420
WSSRPLYSIS AWRPAASRGS GSVVAPDAAA LGLRVPAAEE VAVLVAVEPG RVQYSRGDAG  480
DEAEHPRRRR LLDRVLRLAV PQALAAAAAA DDAEAHASAP QRAENKMMHG LWVQDQGVVD  540
HLAQLVPLLH ECASHVTEGS FEKADFSFKK IRMLTIADGP LQRLSTIIVD SLAHRLLSSI  600
QGLPGALIDP SDYFEKSTLR AARHNFFKLN PYLSTGFVTI NWAIMEAMED EKVDLQVVHI  660
VDLSCSAAHP WQWLKLLDDF HGRPGGAPEL YLTVLHDDND FLADMQSLLS KKAESLGVSF  720
HFISVIGRLE TLDFSNLRST FQIKFGVAVA ISCALQMHRL LLVDDNLSST SIAQLQKMAN  780
FTQPKQMASS VCSPASTLNY LQTPSPRTPK LLARLLSAIR ALKPNIMLIM EQDADHNTLL  840
FRDRFNEVLN YYAALFDCFH AVAAANPGRT DERLRVDRMI LREEIKNILV CEGVHRHERH  900
ERLDQWAMHM EESGFHNVQL SFSAIREAYV WQLKVQADNL RLCCTDRGMF QDDMLSSATS  960
SPASSVYSPS PSPSNGSWVQ ELSHDQQSVR LIGLLYQCAA EVSAGSFDRA NLCLEHITQL  1020
ASLDAPHALQ RLAAVFADAL ARKLLNLILG LSRALLSSAN SADAHLVPVA RRHMFDVLPF  1080
LKLAYLTTNH AILEAMEGER FVHVVDFSGP AANPVQWIAL FHAFRGRREG PPHLRITAVH  1140
DSKEFLANMA AVLSKEAEAF DIAFQFNAVE AKLDEMDFDA LRHDLGVRSG EALAVSVVLQ  1200
LHRLLAVDDG RRHAAAGCLT PVQIIARSSP RSFGELLERE LNTRLQLSPD ASVVSSLSPH  1260
SPAAATAAHP TTSTPKLGSF LSAVRSLSPK IMVMTEQEAN HNGGAFQERF DEALNYYASL  1320
FDCLQRSAAA AAERARVERG AQLLRVAVRL PAAERGGGGG ARARGAGAAR GGDPRRGGVR  1380
GGGAGGAARA GAAVGGADGG GRHGAGGAEL QRRHGGEEAA AELRVGGAVR GEARRRRPWL  1440
LLLLAQEAAL RRHGVAPGGV ATRPHSVVAV HAHVFSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-15279133932375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235270.0AC123527.3 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0068G15, complete sequence.
GenBankAC1514800.0AC151480.1 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNAa0068G15, complete sequence.
GenBankAK1052370.0AK105237.1 Oryza sativa Japonica Group cDNA clone:001-113-A03, full insert sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441716.10.0hypothetical protein SORBIDRAFT_08g001190
TrEMBLA0A0E0R4160.0A0A0E0R416_ORYRU; Uncharacterized protein
STRINGORGLA12G0021500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-64scarecrow-like 3